PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G2261
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 290aa    MW: 32426.3 Da    PI: 5.025
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G2261genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.1e-152067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l+++    G g+W+ +ar  g+ R++k+c++rw +yl
      Gh_D13G2261 20 KGLWSPEEDDKLINYMLTNGQGCWSDVARNAGLQRCGKSCRLRWINYL 67
                     678*******************************************97 PP

2Myb_DNA-binding51.52.3e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ ++eE+el+v+++  lG++ W+ Ia++++ gRt++++k++w++
      Gh_D13G2261  73 RGAISPEEEELIVHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 116
                      7889******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.51567IPR017930Myb domain
SuperFamilySSF466897.81E-2818114IPR009057Homeodomain-like
SMARTSM007172.3E-111969IPR001005SANT/Myb domain
PfamPF002497.0E-142067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-232174IPR009057Homeodomain-like
CDDcd001672.59E-92367No hitNo description
PROSITE profilePS5129425.52568122IPR017930Myb domain
SMARTSM007171.4E-1572120IPR001005SANT/Myb domain
PfamPF002492.0E-1473116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-2575123IPR009057Homeodomain-like
CDDcd001673.65E-1177115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MMRKPNNGST ITTTNNKLRK GLWSPEEDDK LINYMLTNGQ GCWSDVARNA GLQRCGKSCR  60
LRWINYLRPD LKRGAISPEE EELIVHLHSI LGNRWSQIAA RLPGRTDNEI KNFWNSTIKK  120
RLKNSSPNTI GSSTSNFNKD SNPVGFITME QQGVLLPTYI DLSSTSSNSS LQSTVTNPGT  180
AFGATVGYFA TNVNCMYGEN EMLCGEELYM PPLETVRENL KIENTFESDI TTTTTTNNNN  240
NVDCSMKSEN VMTGAAVGNF WLGEEIKVGD WNLEDLMKDV SSFPFLDFQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-281512222128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6153550.0JX615355.1 Gossypium hirsutum clone NBRI_GE59296 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464842.10.0PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV29e-72MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A0D2VIF60.0A0A0D2VIF6_G
STRINGVIT_06s0004g02110.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61152347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.17e-71myb domain protein 46